PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr004276.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 262aa    MW: 29632.3 Da    PI: 9.2614
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr004276.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l+d+++q+G g+W++ ++  g+ R++k+c++rw +yl
      Pbr004276.1 14 KGAWSKEEDQRLIDYIRQHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding621.2e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia++++ gRt++++k++w++y
      Pbr004276.1  67 RGNFTQEEDELIIKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTY 111
                      89********************.*********.************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.213961IPR017930Myb domain
SMARTSM007175.3E-141363IPR001005SANT/Myb domain
SuperFamilySSF466897.4E-3013108IPR009057Homeodomain-like
PfamPF002493.9E-161461IPR001005SANT/Myb domain
CDDcd001678.99E-111661No hitNo description
PROSITE profilePS5129429.07562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2865117IPR009057Homeodomain-like
SMARTSM007179.2E-1966114IPR001005SANT/Myb domain
PfamPF002494.5E-1867111IPR001005SANT/Myb domain
CDDcd001674.39E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRAPCCEKA HTNKGAWSKE EDQRLIDYIR QHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TQEEDELIIK LHSLLGNKWS LIAARLPGRT DNEIKNYWNT YVKRNLISRG  120
LDPQTHRPLN QATTATSTAP ASRLDLRNRP PPSSVVFGHK PINNHSKIEL LKHPKMEQEC  180
YNYNIESEAN CSTATGSGTT TEEDQQQQQQ KYKCGDLNLD LSIGLEPFQS KPTRASSGNS  240
AESRLHQIIV PPNSNNNHLF F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-29141167108B-MYB
1h8a_C5e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN5447040.0JN544704.1 Malus x domestica MYB transcription factor 3 (MYB3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008378762.11e-166PREDICTED: LOW QUALITY PROTEIN: transcription repressor MYB6-like
SwissprotQ388519e-93MYB6_ARATH; Transcription repressor MYB6
TrEMBLJ7F2B81e-151J7F2B8_MALDO; MYB transcription factor 3 (Fragment)
STRINGPOPTR_0019s11090.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.16e-86myb domain protein 6